Structure of PDB 6xqi Chain B Binding Site BS01

Receptor Information
>6xqi Chain B (length=62) Species: 11698 (Human immunodeficiency virus type 1 (NEW YORK-5 ISOLATE)) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQ
LLFIHFRIGCSH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xqi Structure of HIV-1 Vpr in complex with the human nucleotide excision repair protein hHR23A.
Resolution2.34 Å
Binding residue
(original residue number in PDB)		L23 K27 R36 L39 H40 Y47
Binding residue
(residue number reindexed from 1)		L7 K11 R20 L23 H24 Y31
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0019058 viral life cycle
Cellular Component
GO:0042025 host cell nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6xqi, PDBe:6xqi, PDBj:6xqi
PDBsum6xqi
PubMed34824204
UniProtP12520|VPR_HV1N5 Protein Vpr (Gene Name=vpr)

[Back to BioLiP]