Structure of PDB 6xa6 Chain B Binding Site BS01

Receptor Information
>6xa6 Chain B (length=84) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVEEIRLPRAGGPLGLSIVGGSDHQEPGVFISKVLPRGLAARSGLRVGD
RILAVNGQDVRDATHQEAVSALLRLELSLLVRRD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6xa6 Structural basis of the human Scribble-Vangl2 association in health and disease.
Resolution1.95 Å
Binding residue
(original residue number in PDB)
P1013 L1014 G1015 L1016 S1017 I1018 H1024 S1039 K1040 H1071 V1075
Binding residue
(residue number reindexed from 1)
P14 L15 G16 L17 S18 I19 H25 S33 K34 H65 V69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6xa6, PDBe:6xa6, PDBj:6xa6
PDBsum6xa6
PubMed33684218
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]