Structure of PDB 6x8k Chain B Binding Site BS01

Receptor Information
>6x8k Chain B (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY
EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP
VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x8k Caspase-3 in complex with elongated ketomethylene inhibitor
Resolution2.17 Å
Binding residue
(original residue number in PDB)		R64 H121 C163 T166
Binding residue
(residue number reindexed from 1)		R31 H88 C130 T133
Enzymatic activity
Catalytic site (original residue number in PDB) T62 S63 H121 G122 C163
Catalytic site (residue number reindexed from 1) T29 S30 H88 G89 C130
Enzyme Commision number 3.4.22.56: caspase-3.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6x8k, PDBe:6x8k, PDBj:6x8k
PDBsum6x8k
PubMed
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]