Structure of PDB 6x4x Chain B Binding Site BS01

Receptor Information
>6x4x Chain B (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSDLVEALYLVCGERGYFYTKPT
Ligand information
>6x4x Chain A (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x4x Evolution of insulin at the edge of foldability and its medical implications.
ResolutionN/A
Binding residue
(original residue number in PDB)		F22 N24 Q25 H26 L27 C28 L32 L36 V39 C40 R43 G44 Y45 F46 Y47 T51
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 R22 G23 Y24 F25 Y26 T30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6x4x, PDBe:6x4x, PDBj:6x4x
PDBsum6x4x
PubMed33154160
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]