Structure of PDB 6x4s Chain B Binding Site BS01

Receptor Information
>6x4s Chain B (length=151) Species: 7070 (Tribolium castaneum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLSDVKTLVNQLYEALNVREHQLQKEVELTTQLETLQQELLPLEEKKLEL
EQVANRRSNWMAWAGLGLMSVQFGILARLTWWEYSWDIMEPVTYFVTYGT
AMAAYAYFVLTREEYILNDVRDRQQLFDVNQYNVLKDQIAKLELDLKRLR
D
Ligand information
>6x4s Chain F (length=25) Species: 7070 (Tribolium castaneum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IRLILTVVPGLLIGAAISKNIANFL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6x4s Structure and Reconstitution of an MCU-EMRE Mitochondrial Ca 2+ Uniporter Complex.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		W237 S244 V245 F247 I249 R252 E257
Binding residue
(residue number reindexed from 1)		W63 S70 V71 F73 I75 R78 E83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0036444 calcium import into the mitochondrion
GO:0051560 mitochondrial calcium ion homeostasis
Cellular Component
GO:1990246 uniplex complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6x4s, PDBe:6x4s, PDBj:6x4s
PDBsum6x4s
PubMed32841658
UniProtD6WIX5|MCU_TRICA Calcium uniporter protein, mitochondrial (Gene Name=MCU);
D6X268

[Back to BioLiP]