Structure of PDB 6wxq Chain B Binding Site BS01

Receptor Information
>6wxq Chain B (length=212) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLR
AQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMI
NTLILLGIIVSRKRFTVYVRDEGGGSRVISFNDNTIRALMRDYSREEMKL
LNVLYETKGTGITELAKMLDKSEKTLINKIAELKKFGILTQKGKDRKVEL
NELGLNVIKLNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wxq Structural basis of cyclic oligoadenylate binding to the transcription factor Csa3 outlines cross talk between type III and type I CRISPR systems.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		M8 G9 F10 N11 T13 F14 P35 T42 G96 M97 R98 E122
Binding residue
(residue number reindexed from 1)		M8 G9 F10 N11 T13 F14 P35 T42 G96 M97 R98 E122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6wxq, PDBe:6wxq, PDBj:6wxq
PDBsum6wxq
PubMed35038453
UniProtQ97Y88|CSA3_SACS2 CRISPR locus-related putative DNA-binding protein Csa3 (Gene Name=csa3)

[Back to BioLiP]