Structure of PDB 6wo2 Chain B Binding Site BS01

Receptor Information
>6wo2 Chain B (length=101) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGN
DVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
V
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wo2 Some thermodynamic effects of varying nonpolar surfaces in protein-ligand interactions.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
R67 R86 S88 E89 S90 S96 Q106 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)
R14 R33 S35 E36 S37 S43 Q53 H54 F55 K56 L67 W68
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6wo2, PDBe:6wo2, PDBj:6wo2
PDBsum6wo2
PubMed32916312
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]