Structure of PDB 6wms Chain B Binding Site BS01

Receptor Information
>6wms Chain B (length=196) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRDLS
QHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQE
TLIRALRTLIMKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wms Structural basis for heme-dependent NCoR binding to the transcriptional repressor REV-ERB beta.
Resolution2.0 Å
Binding residue
(original residue number in PDB)
V417 K421 Q431 L438 K439
Binding residue
(residue number reindexed from 1)
V37 K41 Q51 L58 K59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6wms, PDBe:6wms, PDBj:6wms
PDBsum6wms
PubMed33571111
UniProtQ14995|NR1D2_HUMAN Nuclear receptor subfamily 1 group D member 2 (Gene Name=NR1D2)

[Back to BioLiP]