Structure of PDB 6wf3 Chain B Binding Site BS01

Receptor Information

>6wf3 Chain B (length=150) Species: 9606 (Homo sapiens)

RIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDI
AVGAVCCRVDHSQNQKRLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDG
TFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNL

Ligand information

>6wf3 Chain H (length=4) Species: 32630 (synthetic construct)

MLGP

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6wf3 Characterization of SpecificN-alpha-Acetyltransferase 50 (Naa50) Inhibitors Identified Using a DNA Encoded Library.
• Resolution: 2.291 Å
• Binding residue (original residue number in PDB): F27 P28 V29 Y31 Y73 M75 H112 Y138 Y139
• Binding residue (residue number reindexed from 1): F23 P24 V25 Y27 Y69 M71 H108 Y134 Y135

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.258: N-terminal methionine N(alpha)-acetyltransferase NatE.

Gene Ontology

Molecular Function

• GO:0004596 peptide alpha-N-acetyltransferase activity
• GO:0005515 protein binding
• GO:0010485 histone H4 acetyltransferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0061733 peptide-lysine-N-acetyltransferase activity
• GO:0120518 peptide-methionine-alpha-N-acetyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006474 N-terminal protein amino acid acetylation
• GO:0007064 mitotic sister chromatid cohesion
• GO:0034087 establishment of mitotic sister chromatid cohesion
• GO:0071962 mitotic sister chromatid cohesion, centromeric

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031415 NatA complex
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6wf3, PDBe:6wf3, PDBj:6wf3
• PDBsum: 6wf3
• PubMed: 32550998
• UniProt: Q9GZZ1|NAA50_HUMAN N-alpha-acetyltransferase 50 (Gene Name=NAA50)