Structure of PDB 6wa0 Chain B Binding Site BS01

Receptor Information
>6wa0 Chain B (length=31) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPETALLVAFVAYYTALIALIFAILATRRLM
Ligand information
>6wa0 Chain A (length=28) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PETALLVAFVAYYTALIALIFAILATRR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wa0 De novo designed receptor transmembrane domains enhance CAR-T cytotoxicity and attenuate cytokine release
Resolution3.484 Å
Binding residue
(original residue number in PDB)		E1 P2 V8 V11 A12 A19 F22
Binding residue
(residue number reindexed from 1)		E1 P2 V8 V11 A12 A19 F22
External links