Structure of PDB 6w11 Chain B Binding Site BS01

Receptor Information
>6w11 Chain B (length=200) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKSYFVTMGFNETFLLRLLNETSAQKEDSLVIVVPSPIVSGTRAAIESLR
AQISRLNYPPPRIYEIEITDFNLALSKILDIILTLPEPIISDLTMGMRMI
NTLILLGIIVSRKRFTVYVRDEGSRVISFNDNTIRALMRDYSREEMKLLN
VLYETKGTELAKMLDKSEINKIAELKKFGILTQRKVELNELGLNVIKLNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6w11 Cyclic Tetra-Adenylate (cA 4 ) Recognition by Csa3; Implications for an Integrated Class 1 CRISPR-Cas Immune Response in Saccharolobus solfataricus.
Resolution2.46 Å
Binding residue
(original residue number in PDB)
G9 F10 N11 F14 P35 V39 T42 M95 M97 R98
Binding residue
(residue number reindexed from 1)
G9 F10 N11 F14 P35 V39 T42 M95 M97 R98
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6w11, PDBe:6w11, PDBj:6w11
PDBsum6w11
PubMed34944496
UniProtQ97Y88|CSA3_SACS2 CRISPR locus-related putative DNA-binding protein Csa3 (Gene Name=csa3)

[Back to BioLiP]