Structure of PDB 6vyp Chain B Binding Site BS01

Receptor Information
>6vyp Chain B (length=81) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAV
TYTEHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>6vyp Chain I (length=191) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcgaccctatacgcggccgccctggagaatcccggtgccgaggccgctc
aattggtcgtagacagctctagcaccgcttaaacgcacgtacgcgctgtc
ccccgcgttttaaccgccaaggggattactccctagtctccaggcacgtg
tcagatatatacatcctgtgcatgtattgaacagcgacgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vyp Crystal Structure of the LSD1/CoREST Histone Demethylase Bound to Its Nucleosome Substrate.
Resolution4.99 Å
Binding residue
(original residue number in PDB)		K31 P32 R36
Binding residue
(residue number reindexed from 1)		K11 P12 R16
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vyp, PDBe:6vyp, PDBj:6vyp
PDBsum6vyp
PubMed32396821
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]