Structure of PDB 6vo5 Chain B Binding Site BS01

Receptor Information
>6vo5 Chain B (length=318) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLFGDDETAF
GYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPP
GFCTNTNDFLSLLEKEVDFKPFGTLLHTYSVLENFTFQIYKADMTCRGFR
EYHERLQTFLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYM
TVYNYYVYPDKTRPRVSQMLILTPFQGQGHGAQLLETVHRYYTEFPTVLD
ITAEDPSKSYVKLRDFVLVKLCQDLPCFSREKLMQGFNEDMAIEAQQKFK
INKQHARRVYEILRLLVT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vo5 Crystal structure of Human histone acetytransferas 1 (HAT1) in complex with isobutryl-COA and K12A mutant variant of histone H4
Resolution1.6 Å
Binding residue
(original residue number in PDB)		Y55 H57 Q58 D62 E64 E187 T188 S190 W199 Y225 Y227 R237 S239 Q240 E276
Binding residue
(residue number reindexed from 1)		Y38 H40 Q41 D45 E47 E165 T166 S168 W177 Y203 Y205 R215 S217 Q218 E254
Enzymatic activity
Catalytic site (original residue number in PDB) M241 E276
Catalytic site (residue number reindexed from 1) M219 E254
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
Gene Ontology
Molecular Function
GO:0004402 histone acetyltransferase activity
GO:0042393 histone binding
Biological Process
GO:0006325 chromatin organization
GO:0031509 subtelomeric heterochromatin formation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vo5, PDBe:6vo5, PDBj:6vo5
PDBsum6vo5
PubMed
UniProtO14929|HAT1_HUMAN Histone acetyltransferase type B catalytic subunit (Gene Name=HAT1)

[Back to BioLiP]