Structure of PDB 6vil Chain B Binding Site BS01

Receptor Information
>6vil Chain B (length=152) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLWKWSGNPTQRRKARKLFYKAIVRGKETLRIGDCAVFLSAGRPNLPYIG
RIESLWESWGSNMVVKVKWFYHPEETKLGKRQSDGKNALYQSCHEDENDV
QTISHKCQVVGREQYEQMMRGRKYQDQQDLYYLAGTYDPTTGRLVTADGV
PV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vil BAHCC1 binds H3K27me3 via a conserved BAH module to mediate gene silencing and oncogenesis.
Resolution3.301 Å
Binding residue
(original residue number in PDB)
L2528 A2530 Y2537 W2558 Y2560 C2582 H2583 D2585 N2587 D2588 T2591 P2628 T2629
Binding residue
(residue number reindexed from 1)
L39 A41 Y48 W69 Y71 C93 H94 D96 N98 D99 T102 P139 T140
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding

View graph for
Molecular Function
External links
PDB RCSB:6vil, PDBe:6vil, PDBj:6vil
PDBsum6vil
PubMed33139953
UniProtQ3UHR0|BAHC1_MOUSE BAH and coiled-coil domain-containing protein 1 (Gene Name=Bahcc1)

[Back to BioLiP]