Structure of PDB 6vfs Chain B Binding Site BS01

Receptor Information
>6vfs Chain B (length=318) Species: 487 (Neisseria meningitidis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLPTPAEIVANLNDHVIGQEQAKKALAVSVYNHYKRLRHKSNILLIGPTG
SGKTLLAQSLARKLDVPFVMADATTLTEAGYVGEDVEQIITKLLGKCDFD
VEKAQRGIVYIDQIDKISRTRDVSGEGVQQALLKLIEGTVASVPPQINVD
TTNILFICGGAFAGLEKVIRQRTEKGGIGFGASVHADITKLFGIVEPEDL
IKFGLIPELIGRLPVIATLEILDEDALINILTEPKNALVKQYQALFGMEN
VELEFEEGALRSIARQAMERKTGARGLRSIVERCLLDTMYRLPDLKGLKK
VVVGKAVIEEGREPELVF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vfs A processive rotary mechanism couples substrate unfolding and proteolysis in the ClpXP degradation machinery.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		G152 Y153 V154
Binding residue
(residue number reindexed from 1)		G80 Y81 V82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0008270 zinc ion binding
GO:0016887 ATP hydrolysis activity
GO:0046872 metal ion binding
GO:0046983 protein dimerization activity
GO:0051082 unfolded protein binding
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0006457 protein folding
GO:0051301 cell division
GO:0051603 proteolysis involved in protein catabolic process
Cellular Component
GO:0009376 HslUV protease complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vfs, PDBe:6vfs, PDBj:6vfs
PDBsum6vfs
PubMed31916936
UniProtQ9JYY3|CLPX_NEIMB ATP-dependent Clp protease ATP-binding subunit ClpX (Gene Name=clpX)

[Back to BioLiP]