Structure of PDB 6uib Chain B Binding Site BS01

Receptor Information
>6uib Chain B (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LIWELKKDVYVVELDAPGEMVVLTCDWTLDQSSEVLGSGKTLTIQVKEFG
DAGQYTCHHSLLLLHKKEDGIWSTDILKDQNKTFLRCEAKNYSGRFTCWW
LTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVEYEYSVECQEDSAC
PAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNS
RQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKKKDRVFTDKTSATVICR
KSISVRAQDRYYSSSWSEWASVPC
Ligand information
>6uib Chain C (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TKSFCYFGTWCQMYG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uib Integration of phage and yeast display platforms: A reliable and cost effective approach for binning of peptides as displayed on-phage.
Resolution2.74 Å
Binding residue
(original residue number in PDB)		T250 F268 T269 Q289 R291 S294 W297
Binding residue
(residue number reindexed from 1)		T223 F239 T240 Q258 R260 S263 W266
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004896 cytokine receptor activity
GO:0005125 cytokine activity
GO:0005126 cytokine receptor binding
GO:0005143 interleukin-12 receptor binding
GO:0005515 protein binding
GO:0008083 growth factor activity
GO:0019955 cytokine binding
GO:0042164 interleukin-12 alpha subunit binding
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0045519 interleukin-23 receptor binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0001817 regulation of cytokine production
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002230 positive regulation of defense response to virus by host
GO:0002323 natural killer cell activation involved in immune response
GO:0002827 positive regulation of T-helper 1 type immune response
GO:0002860 positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
GO:0002862 negative regulation of inflammatory response to antigenic stimulus
GO:0007166 cell surface receptor signaling pathway
GO:0007259 cell surface receptor signaling pathway via JAK-STAT
GO:0008283 cell population proliferation
GO:0010224 response to UV-B
GO:0016477 cell migration
GO:0019221 cytokine-mediated signaling pathway
GO:0019953 sexual reproduction
GO:0030101 natural killer cell activation
GO:0032693 negative regulation of interleukin-10 production
GO:0032700 negative regulation of interleukin-17 production
GO:0032725 positive regulation of granulocyte macrophage colony-stimulating factor production
GO:0032729 positive regulation of type II interferon production
GO:0032733 positive regulation of interleukin-10 production
GO:0032735 positive regulation of interleukin-12 production
GO:0032740 positive regulation of interleukin-17 production
GO:0032760 positive regulation of tumor necrosis factor production
GO:0032816 positive regulation of natural killer cell activation
GO:0032819 positive regulation of natural killer cell proliferation
GO:0032946 positive regulation of mononuclear cell proliferation
GO:0034105 positive regulation of tissue remodeling
GO:0034393 positive regulation of smooth muscle cell apoptotic process
GO:0035722 interleukin-12-mediated signaling pathway
GO:0042088 T-helper 1 type immune response
GO:0042093 T-helper cell differentiation
GO:0042098 T cell proliferation
GO:0042102 positive regulation of T cell proliferation
GO:0042104 positive regulation of activated T cell proliferation
GO:0042832 defense response to protozoan
GO:0043382 positive regulation of memory T cell differentiation
GO:0045672 positive regulation of osteoclast differentiation
GO:0045785 positive regulation of cell adhesion
GO:0048662 negative regulation of smooth muscle cell proliferation
GO:0050671 positive regulation of lymphocyte proliferation
GO:0050709 negative regulation of protein secretion
GO:0050729 positive regulation of inflammatory response
GO:0050829 defense response to Gram-negative bacterium
GO:0051135 positive regulation of NK T cell activation
GO:0051142 positive regulation of NK T cell proliferation
GO:0051607 defense response to virus
GO:0071222 cellular response to lipopolysaccharide
GO:0071346 cellular response to type II interferon
GO:1900747 negative regulation of vascular endothelial growth factor signaling pathway
GO:1901224 positive regulation of non-canonical NF-kappaB signal transduction
GO:1903588 negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis
GO:2000318 positive regulation of T-helper 17 type immune response
GO:2000330 positive regulation of T-helper 17 cell lineage commitment
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm
GO:0005788 endoplasmic reticulum lumen
GO:0005829 cytosol
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0031906 late endosome lumen
GO:0043235 receptor complex
GO:0043514 interleukin-12 complex
GO:0070743 interleukin-23 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uib, PDBe:6uib, PDBj:6uib
PDBsum6uib
PubMed32479512
UniProtP29460|IL12B_HUMAN Interleukin-12 subunit beta (Gene Name=IL12B)

[Back to BioLiP]