Structure of PDB 6uhc Chain B Binding Site BS01

Receptor Information
>6uhc Chain B (length=374) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIREIKDLMVGDEASE
LRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPP
MNPTKNREKIVEVMFETYQFSGVYVAIQAVLTLYAQGLLTGVVVDSGDGV
THICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADFETV
RMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPE
ALFQHLINVEGVGVAELLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLP
SRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRRKHMVFLGGAVLADI
MKDKDNFWMTRQEYQEKGVRVLEK
Ligand information
>6uhc Chain H (length=21) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVGALMEVMQKRSKAIEWED
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uhc Cryo-EM structure of NPF-bound human Arp2/3 complex and activation mechanism.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		Y147 G150 R343 M365
Binding residue
(residue number reindexed from 1)		Y134 G137 R329 M351
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0005200 structural constituent of cytoskeleton
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0051015 actin filament binding
Biological Process
GO:0007163 establishment or maintenance of cell polarity
GO:0008356 asymmetric cell division
GO:0010592 positive regulation of lamellipodium assembly
GO:0016344 meiotic chromosome movement towards spindle pole
GO:0016482 cytosolic transport
GO:0030036 actin cytoskeleton organization
GO:0033206 meiotic cytokinesis
GO:0034314 Arp2/3 complex-mediated actin nucleation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051321 meiotic cell cycle
GO:0051653 spindle localization
GO:0060271 cilium assembly
GO:0071346 cellular response to type II interferon
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2001032 regulation of double-strand break repair via nonhomologous end joining
Cellular Component
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005885 Arp2/3 protein complex
GO:0005925 focal adhesion
GO:0005938 cell cortex
GO:0015629 actin cytoskeleton
GO:0016020 membrane
GO:0030478 actin cap
GO:0035578 azurophil granule lumen
GO:0035861 site of double-strand break
GO:0042995 cell projection
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uhc, PDBe:6uhc, PDBj:6uhc
PDBsum6uhc
PubMed32548263
UniProtP61160|ARP2_HUMAN Actin-related protein 2 (Gene Name=ACTR2)

[Back to BioLiP]