Structure of PDB 6uep Chain B Binding Site BS01

Receptor Information
>6uep Chain B (length=191) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAA
VIMRIREPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAK
FKDFKIQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPK
IVLLIFVSGKIVITGAKMRDETYKAFENIYPVLSEFRKIQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6uep DNA mismatches reveal conformational penalties in protein-DNA recognition.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		V29 T31 F57 F74 S76 K78 V80 Q116 N117 L147 F148 R154 L163 T173
Binding residue
(residue number reindexed from 1)		V20 T22 F48 F65 S67 K69 V71 Q107 N108 L138 F139 R145 L154 T164
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0005975 carbohydrate metabolic process
GO:0006352 DNA-templated transcription initiation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6uep, PDBe:6uep, PDBj:6uep
PDBsum6uep
PubMed33087930
UniProtP28147|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]