Structure of PDB 6ubh Chain B Binding Site BS01

Receptor Information
>6ubh Chain B (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSMEIRVRVEKDPELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASK
LLQPGDKIIQANGYSFINIEMGQAVSLLKTFQNTVELIIVRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ubh Comprehensive Assessment of the Relationship Between Site -2 Specificity and Helix alpha 2 in the Erbin PDZ Domain.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E32 L33 G34 F35 S36 I37 T58 R59 M89
Binding residue
(residue number reindexed from 1)		E14 L15 G16 F17 S18 I19 T40 R41 M71
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ubh, PDBe:6ubh, PDBj:6ubh
PDBsum6ubh
PubMed34171344
UniProtQ96RT1|ERBIN_HUMAN Erbin (Gene Name=ERBIN)

[Back to BioLiP]