Structure of PDB 6u8g Chain B Binding Site BS01

Receptor Information
>6u8g Chain B (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVK
LNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNK
PGDDIVLMAEALEKLFLQKINELPTE
Ligand information
>6u8g Chain F (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKTIKGATWRTKQC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6u8g Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		F83 V87 L94 I100 I138 Y139 N140 K141 D144
Binding residue
(residue number reindexed from 1)		F42 V46 L53 I59 I97 Y98 N99 K100 D103
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6u8g, PDBe:6u8g, PDBj:6u8g
PDBsum6u8g
PubMed33046654
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]