Structure of PDB 6u0o Chain B Binding Site BS01

Receptor Information

>6u0o Chain B (length=288) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KGSIFGIIGLVVIFAVVSFLFFSMISDQIFFKHVKSDIKIEKLNVTLNDA
AKKQINNYTSQQVSNKKNDAWRDASATEIKSAMDSGTFIDNEKQKYQFLD
LSKYQGIDKNRIKRMLVDRPTLLKHTDDFLKAAKDKHVNEVYLISHALLE
TGAVKSELANGVEIDGKKYYNFYGVGALDKDPIKTGAEYAKKHGWDTPEK
AISGGADFIHKHFLSSTDQNTLYSMRWNPKNPGEHQYATDIKWAESNATI
IADFYKNMKTEGKYFKYFVYKDDSKHLNKKLAAALEHH

Ligand information

>6u0o Chain D (length=5) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KDDDD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6u0o Structure and reconstitution of a hydrolase complex that may release peptidoglycan from the membrane after polymerization.
Resolution	2.6 Å
Binding residue (original residue number in PDB)	D42 K44 I45 E46 K47 L48 K235
Binding residue (residue number reindexed from 1)	D37 K39 I40 E41 K42 L43 K230

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004040	amidase activity

	Cellular Component
GO:0005576	extracellular region
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6u0o, PDBe:6u0o, PDBj:6u0o
PDBsum	6u0o
PubMed	33168989
UniProt	Q2FXF4

[Back to BioLiP]