Structure of PDB 6tqo Chain B Binding Site BS01

Receptor Information
>6tqo Chain B (length=134) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLA
GVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVA
INEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPN
Ligand information
>6tqo Chain R (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugcucuuuaacaauuuaucagaucuguguggguggcguguggc
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqo Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		A4 R7 R72 L77 Y100 V102 N105 I108 E109 K112 E117 D118 K121 F122 N124 G125 V126
Binding residue
(residue number reindexed from 1)		A1 R4 R69 L74 Y97 V99 N102 I105 E106 K109 E114 D115 K118 F119 N121 G122 V123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqo, PDBe:6tqo, PDBj:6tqo
PDBsum6tqo
PubMed32871103
UniProtP0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]