Structure of PDB 6tqn Chain B Binding Site BS01

Receptor Information
>6tqn Chain B (length=134) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLA
GVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVA
INEAIELAKSFGAEDSHKFVNGVLDKAAPVIRPN
Ligand information
>6tqn Chain R (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugcucuuuaacaauuuaucagaucuguguggguggcguguggc
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqn Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		A4 R7 Y69 S71 R72 L77 E81 K101 V102 I104 N105 I108 E109 K112 D118 S119 K121 F122 N124 G125 D128
Binding residue
(residue number reindexed from 1)		A1 R4 Y66 S68 R69 L74 E78 K98 V99 I101 N102 I105 E106 K109 D115 S116 K118 F119 N121 G122 D125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0006353 DNA-templated transcription termination
GO:0006355 regulation of DNA-templated transcription
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tqn, PDBe:6tqn, PDBj:6tqn
PDBsum6tqn
PubMed32871103
UniProtP0A780|NUSB_ECOLI Transcription antitermination protein NusB (Gene Name=nusB)

[Back to BioLiP]