Structure of PDB 6tqa Chain B Binding Site BS01

Receptor Information
>6tqa Chain B (length=149) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QQLSSNLWAAVRARGCQFLGPAMQEEALKLVLLALEDGSALSRKVLVLFV
VQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTY
EALRREHDSQIVQIAMEAGLRIAPDQWSSLLYGDQSHKSHMQSIIDKLQ
Ligand information
>6tqa Chain F (length=21) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggugccuaauauuuaggcacc
<<<<<<<<<...>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqa Structural basis for the recognition of transiently structured AU-rich elements by Roquin.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R188 R219 K220 S238 K239 T240 Q247 Y250 R251 S253 K259 D263 S264
Binding residue
(residue number reindexed from 1)		R12 R43 K44 S62 K63 T64 Q71 Y74 R75 S77 K83 D87 S88
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:6tqa, PDBe:6tqa, PDBj:6tqa
PDBsum6tqa
PubMed32491174
UniProtQ4VGL6|RC3H1_MOUSE Roquin-1 (Gene Name=Rc3h1)

[Back to BioLiP]