Structure of PDB 6tgx Chain B Binding Site BS01

Receptor Information

>6tgx Chain B (length=172) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TICFRPINPSDLERLEQIHRDIFPIRYESEFFQNVVNGGDIVSWAAVDRS
RPDGHSEELIGFVTAKIVLAKESEISDLIRSKGEGTLVYILTLGVVETYR
KRGIAKALINEVVKYSSGIPVCRGVYLHVIAHNNPAIRLYKRMSFRCVRR
LHGFYLINGQHFDSYLFVYFIN

Ligand information

>6tgx Chain D (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

MVNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6tgx The Arabidopsis N alpha -acetyltransferase NAA60 locates to the plasma membrane and is vital for the high salt stress response.
Resolution	1.77 Å
Binding residue (original residue number in PDB)	F46 Y50 L117 F180 Y181
Binding residue (residue number reindexed from 1)	F23 Y27 L91 F154 Y155

Enzymatic activity

Enzyme Commision number

2.3.1.259: N-terminal methionine N(alpha)-acetyltransferase NatF.
2.3.1.48: histone acetyltransferase.

Gene Ontology

	Molecular Function
GO:0004596	peptide alpha-N-acetyltransferase activity
GO:0016747	acyltransferase activity, transferring groups other than amino-acyl groups

View graph for
Molecular Function

External links

PDB	RCSB:6tgx, PDBe:6tgx, PDBj:6tgx
PDBsum	6tgx
PubMed	32548857
UniProt	Q6NLS5

[Back to BioLiP]