Structure of PDB 6sy0 Chain B Binding Site BS01

Receptor Information
>6sy0 Chain B (length=132) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QEPVILIDKIERCLVVEWYENNIRREQRISYKKYGNDKAKLRAKELIEKL
KSGITFEQLYPDKGPPIVRVFENVGVYNVSLIRDRIEREWRVEWLENGVP
MKARWSCKKVGNDEAQKRADTFAQSMIKGIFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sy0 Structural and functional analysis of the Plasmodium falciparum SIP2 DNA binding domain
Resolution3.102 Å
Binding residue
(original residue number in PDB)		R19 K39 K40 G42 N43 K45 D69 R95 K115 G118 N119
Binding residue
(residue number reindexed from 1)		R12 K32 K33 G35 N36 K38 D62 R88 K108 G111 N112
Enzymatic activity
Enzyme Commision number ?
External links