Structure of PDB 6sx2 Chain B Binding Site BS01

Receptor Information
>6sx2 Chain B (length=72) Species: 437402 (Influenza A virus (A/turkey/Italy/977/1999(H7N1))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDSNTITSFQVDCYLWHIRKLLSMRDMCDAPFDDRLRADQAALKGRGSTL
GLDLRVATMEGKKIVEDILKSE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sx2 Structure and Sequence Determinants Governing the Interactions of RNAs with Influenza A Virus Non-Structural Protein NS1.
Resolution1.9 Å
Binding residue
(original residue number in PDB)
P31 A42 G45 R46 T49
Binding residue
(residue number reindexed from 1)
P31 A42 G45 R46 T49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6sx2, PDBe:6sx2, PDBj:6sx2
PDBsum6sx2
PubMed32867106
UniProtQ1PST0

[Back to BioLiP]