Structure of PDB 6sty Chain B Binding Site BS01

Receptor Information

>6sty Chain B (length=190) Species: 9606 (Homo sapiens)

GAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGP
NLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKESTITLQQAEYEFLSFVR
QQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRW
YPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKI

Ligand information

>6sty Chain C (length=3)

auc

...

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6sty Human REXO2 controls short mitochondrial RNAs generated by mtRNA processing and decay machinery to prevent accumulation of double-stranded RNA.
• Resolution: 3.15 Å
• Binding residue (original residue number in PDB): E49 M50 G52 L53 W96 H100 H101 N142 S143 E146
• Binding residue (residue number reindexed from 1): E20 M21 G23 L24 W67 H71 H72 N113 S114 E117

Enzymatic activity

• Enzyme Commision number: 3.1.15.-

Gene Ontology

Molecular Function

• GO:0000175 3'-5'-RNA exonuclease activity
• GO:0000287 magnesium ion binding
• GO:0003676 nucleic acid binding
• GO:0004527 exonuclease activity
• GO:0008296 3'-5'-DNA exonuclease activity
• GO:0008408 3'-5' exonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006139 nucleobase-containing compound metabolic process
• GO:0006259 DNA metabolic process
• GO:0009117 nucleotide metabolic process

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005758 mitochondrial intermembrane space
• GO:0005759 mitochondrial matrix
• GO:0005925 focal adhesion

External links

• PDB: RCSB:6sty, PDBe:6sty, PDBj:6sty
• PDBsum: 6sty
• PubMed: 32365187
• UniProt: Q9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)