Structure of PDB 6ssq Chain B Binding Site BS01

Receptor Information
>6ssq Chain B (length=249) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLVPRGSHMESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADH
RVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACL
DILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQL
LPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKR
RPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMME
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ssq Regulation of RXR-RAR Heterodimers by RXR- and RAR-Specific Ligands and Their Combinations.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
K237 I247 Q250 I251 P401 L402 E405 M406
Binding residue
(residue number reindexed from 1)
K78 I88 Q91 I92 P242 L243 E246 M247
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004879 nuclear receptor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0048384 retinoic acid receptor signaling pathway
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6ssq, PDBe:6ssq, PDBj:6ssq
PDBsum6ssq
PubMed31694317
UniProtP10826|RARB_HUMAN Retinoic acid receptor beta (Gene Name=RARB)

[Back to BioLiP]