Structure of PDB 6sqk Chain B Binding Site BS01

Receptor Information
>6sqk Chain B (length=333) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKSERDQLYYECYSDVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLD
VGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPG
PVETVELPERVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPAS
AELFVAPISDQMLEWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVV
QDLSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGF
AVWFQVTFPGGPLVLSTSPLHPATHWKQALLYLNEPVPVEQDTDISGEIT
LLPSPDNPRRLRILLRYKVGDHEEKTKDFAMED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sqk Crystal structure of mouse PRMT6 in complex with inhibitors
Resolution1.4 Å
Binding residue
(original residue number in PDB)		Y54 V59 M63 G93 E115 A116 P142 V143 E144 E158 M160 H166 E167 M169 S172 H320 W321
Binding residue
(residue number reindexed from 1)		Y13 V18 M22 G52 E74 A75 P101 V102 E103 E117 M119 H125 E126 M128 S131 H275 W276
Enzymatic activity
Enzyme Commision number 2.1.1.319: type I protein arginine methyltransferase.
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008469 histone arginine N-methyltransferase activity
GO:0016274 protein-arginine N-methyltransferase activity
GO:0035241 protein-arginine omega-N monomethyltransferase activity
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0042393 histone binding
GO:0044020 histone H4R3 methyltransferase activity
GO:0070611 histone H3R2 methyltransferase activity
GO:0070612 histone H2AR3 methyltransferase activity
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0010821 regulation of mitochondrion organization
GO:0018216 peptidyl-arginine methylation
GO:0032259 methylation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0090398 cellular senescence
GO:1901796 regulation of signal transduction by p53 class mediator
GO:2000059 negative regulation of ubiquitin-dependent protein catabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sqk, PDBe:6sqk, PDBj:6sqk
PDBsum6sqk
PubMed
UniProtQ6NZB1|ANM6_MOUSE Protein arginine N-methyltransferase 6 (Gene Name=Prmt6)

[Back to BioLiP]