Structure of PDB 6sok Chain B Binding Site BS01

Receptor Information

>6sok Chain B (length=122) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EAGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVKP

Ligand information

>6sok Chain Q (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SHPQFEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6sok The Role of Changing Loop Conformations in Streptavidin Versions Engineered for High-affinity Binding of the Strep-tag II Peptide.
Resolution	1.96 Å
Binding residue (original residue number in PDB)	T45 A46 R47 Y54 W79 R84 S88 T90 W108
Binding residue (residue number reindexed from 1)	T32 A33 R34 Y41 W66 R71 S75 T77 W95

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:6sok, PDBe:6sok, PDBj:6sok
PDBsum	6sok
PubMed	33639211
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]