Structure of PDB 6snc Chain B Binding Site BS01

Receptor Information
>6snc Chain B (length=230) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLVESGPGLVQPWGTLSLTCRVSGDSVSNDNYYWAWIRQTPGRELQVIG
TIYYSGTTYYNPSLRNRVTISLDKSVNVVSLRLGSVSAADTAQYYCVRMP
SHGFWSTSFSYWYFDLWGRGHFVAVSWASTKGPSVFPLAPSSKSTSGGTA
ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SSLGTQTYICNVDHKPSNTKVDKKVEPKSC
Ligand information
>6snc Chain C (length=19) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKLFIMIV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6snc Structural Basis for Broad HIV-1 Neutralization by the MPER-Specific Human Broadly Neutralizing Antibody LN01.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y35 T50 Y58 F100 F100E S100F W100H
Binding residue
(residue number reindexed from 1)		Y34 T51 Y59 F104 F109 S110 W112
External links