Structure of PDB 6sh8 Chain B Binding Site BS01

Receptor Information
>6sh8 Chain B (length=151) Species: 930945 (Sulfolobus islandicus REY15A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LYEEDYKLALEAFKKVFNALTHYGAKQAFRSRARDLVEEIYNSGFIPTFF
YIISKAELNSDSLDSLISLFSSDNAILRGSDENVSYSAYLFIILYYLIKR
GIIEQKFLIQALRCEKTRLDLIDKLYNLAPIISAKIRTYLLAIKRLSEAL
I
Ligand information
>6sh8 Chain U (length=32) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaagucugguuucccuccaggguaucuuga
................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sh8 Structures of the Cmr-beta Complex Reveal the Regulation of the Immunity Mechanism of Type III-B CRISPR-Cas.
Resolution3.14 Å
Binding residue
(original residue number in PDB)		Y24 G25 A26 Q28 A29 R31 S32 R35 E83 E149
Binding residue
(residue number reindexed from 1)		Y23 G24 A25 Q27 A28 R30 S31 R34 E82 E148
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sh8, PDBe:6sh8, PDBj:6sh8
PDBsum6sh8
PubMed32730741
UniProtF0NDX5

[Back to BioLiP]