Structure of PDB 6scs Chain B Binding Site BS01

Receptor Information
>6scs Chain B (length=67) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPVELHSFEDAQVIGGAFRDGDAVVFDMSLLSREEARRIVDFAAGLCFAL
RGKMQKIDSVTFAVVPE
Ligand information
>6scs Chain P (length=10) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDLDVPSFLQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6scs Essential dynamic interdependence of FtsZ and SepF for Z-ring and septum formation in Corynebacterium glutamicum.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		R102 A113 F117 M123 K125 S128 F131
Binding residue
(residue number reindexed from 1)		R33 A44 F48 M54 K56 S59 F62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:6scs, PDBe:6scs, PDBj:6scs
PDBsum6scs
PubMed32242019
UniProtQ8NNN6

[Back to BioLiP]