Structure of PDB 6sat Chain B Binding Site BS01

Receptor Information
>6sat Chain B (length=87) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YQSTIVPVELHSFEDAQVIGGAFRDGDAVVFDMSLLSREEARRIVDFAAG
LCFALRGKMQKIDSVTFAVVPELSNISTSELERAARI
Ligand information
>6sat Chain P (length=9) Species: 196627 (Corynebacterium glutamicum ATCC 13032) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DLDVPSFLQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sat Essential dynamic interdependence of FtsZ and SepF for Z-ring and septum formation in Corynebacterium glutamicum.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		R106 V109 F117 Q124 K125 F131
Binding residue
(residue number reindexed from 1)		R42 V45 F53 Q60 K61 F67
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0090529 cell septum assembly

View graph for
Biological Process
External links
PDB RCSB:6sat, PDBe:6sat, PDBj:6sat
PDBsum6sat
PubMed32242019
UniProtQ8NNN6

[Back to BioLiP]