Structure of PDB 6s9l Chain B Binding Site BS01

Receptor Information
>6s9l Chain B (length=283) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSELPQMVQQLNSPDQQELQSALWKLRNIASGGNEQIQAVIDAGALPALV
QLLSSPNEQILSSALGALSNIASGGNEQIQAVIDAGALPALVQLLSSPNE
QILQLALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW
ALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASG
GNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAV
KEAGALEKLEQLQSHENEKIQKEAQEALEKLQS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s9l Structure-Guided Design of a Peptide Lock for Modular Peptide Binders.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		R36 S40 N79 S82 W117 S120 N121 S124 G125 W159 N163 S166 G167 W201 N205 S208 W243 S246 N247 E282
Binding residue
(residue number reindexed from 1)		R27 S31 N70 S73 W108 S111 N112 S115 G116 W150 N154 S157 G158 W192 N196 S199 W234 S237 N238 E273
External links