Structure of PDB 6s6h Chain B Binding Site BS01

Receptor Information
>6s6h Chain B (length=140) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLAVLEIGIIENVQRADLNVLEEALSYKVLMEKFERTQENIAQTIGKSRS
HVANTMRLLALPDEVQSYLVSGELTAGHARAIAAAADPVALAKQIIEGGL
SVRETEALARKAPNLSAGKSKGGRPPRVKDKLAAALEHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s6h Diversification of DNA-Binding Specificity by Permissive and Specificity-Switching Mutations in the ParB/Noc Protein Family.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		K171 S172 S174 H175 T199 G201 H202 R204 S225 V226 R227
Binding residue
(residue number reindexed from 1)		K47 S48 S50 H51 T75 G77 H78 R80 S101 V102 R103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6s6h, PDBe:6s6h, PDBj:6s6h
PDBsum6s6h
PubMed32698006
UniProtB8GW30|PARB_CAUVN Chromosome-partitioning protein ParB (Gene Name=parB)

[Back to BioLiP]