Structure of PDB 6s0y Chain B Binding Site BS01

Receptor Information
>6s0y Chain B (length=119) Species: 9844 (Lama glama) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VQLQESGGGLVQTGGSLRLSCAFSGSDDYVIGWFRQAPGKGRQGVSCIRL
SGGGTIYADSAKGRFTVSADNAKKTVYLQMTRLKPEDTAVYYCGAERYNV
EGCGYDVAYWGKGTQVTVS
Ligand information
>6s0y Chain C (length=14) Species: 526896 (Influenza A virus (A/Jeju/2279/2007(H1N1))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVETPIRNEWGCRC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s0y Selective Engagement of Fc gamma RIV by a M2e-Specific Single Domain Antibody Construct Protects Against Influenza A Virus Infection.
Resolution1.81 Å
Binding residue
(original residue number in PDB)		S7 G8
Binding residue
(residue number reindexed from 1)		S6 G7
External links