Structure of PDB 6s0m Chain B Binding Site BS01

Receptor Information
>6s0m Chain B (length=158) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRTH
VLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALC
QLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQL
RRFRLITS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6s0m Structural and dynamic studies provide insights into specificity and allosteric regulation of ribonuclease as, a key enzyme in mycobacterial virulence.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		D6 E8 F9 W46 H140
Binding residue
(residue number reindexed from 1)		D6 E8 F9 W46 H140
Enzymatic activity
Enzyme Commision number 3.1.13.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003676 nucleic acid binding
GO:0004527 exonuclease activity
GO:0004532 RNA exonuclease activity
GO:0008408 3'-5' exonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6s0m, PDBe:6s0m, PDBj:6s0m
PDBsum6s0m
PubMed31299874
UniProtP9WJ73|EXRBN_MYCTU 3'-5' exoribonuclease Rv2179c (Gene Name=Rv2179c)

[Back to BioLiP]