Structure of PDB 6rt6 Chain B Binding Site BS01

Receptor Information
>6rt6 Chain B (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTSKLKYVLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRS
ARSVILIFSVRESGKFQGFARLSSESHHIHWVLPAGMSAKMLGGVFKIDW
ICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFPPDES
IDLYQVIHKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rt6 Flexible Binding of m6A Reader Protein YTHDC1 to Its Preferred RNA Motif.
Resolution1.461 Å
Binding residue
(original residue number in PDB)		K361 S362 N363 N367 W377 S378 R404 W428 L439 G474 D476
Binding residue
(residue number reindexed from 1)		K18 S19 N20 N24 W34 S35 R61 W81 L92 G127 D129
Binding affinityPDBbind-CN: Kd=11.1uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6rt6, PDBe:6rt6, PDBj:6rt6
PDBsum6rt6
PubMed31670957
UniProtQ96MU7|YTDC1_HUMAN YTH domain-containing protein 1 (Gene Name=YTHDC1)

[Back to BioLiP]