Structure of PDB 6rt4 Chain B Binding Site BS01

Receptor Information
>6rt4 Chain B (length=160) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GTSKLKYVLQDARFFLIKSNNHENVSLAKAKGVWSTLPVNEKKLNLAFRS
ARSVILIFSVRESGKFQGFARLSSESHHIHWVLPAGMSAKMLGGVFKIDW
ICRRELPFTKSAHLTNPWNEHKPVKIGRDGQEIELECGTQLCLLFPPDES
IDLYQVIHKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rt4 Flexible Binding of m6A Reader Protein YTHDC1 to Its Preferred RNA Motif.
Resolution1.49 Å
Binding residue
(original residue number in PDB)		K361 S362 N363 N367 W377 S378 R404 E405 W428 P431 K472 I473 G474 R475 D476
Binding residue
(residue number reindexed from 1)		K18 S19 N20 N24 W34 S35 R61 E62 W81 P84 K125 I126 G127 R128 D129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6rt4, PDBe:6rt4, PDBj:6rt4
PDBsum6rt4
PubMed31670957
UniProtQ96MU7|YTDC1_HUMAN YTH domain-containing protein 1 (Gene Name=YTHDC1)

[Back to BioLiP]