Structure of PDB 6roy Chain B Binding Site BS01

Receptor Information
>6roy Chain B (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVT
HIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPL
NC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6roy Molecular mechanism of SHP2 activation by PD-1 stimulation.
Resolution2.1 Å
Binding residue
(original residue number in PDB)
R32 S34 K35 S36 T42 V51 H53 I54 K55 L65 G67 G68 Q87 K89 E90 K91
Binding residue
(residue number reindexed from 1)
R30 S32 K33 S34 T40 V49 H51 I52 K53 L63 G65 G66 Q85 K87 E88 K89
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:6roy, PDBe:6roy, PDBj:6roy
PDBsum6roy
PubMed32064351
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]