Structure of PDB 6rcn Chain B Binding Site BS01

Receptor Information
>6rcn Chain B (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQT
ITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHY
RIIDVSTVKELCRRWYPEEYEFAPSHRALDAISESIKELQFYRNNIFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rcn Dinucleotide Degradation by REXO2 Maintains Promoter Specificity in Mammalian Mitochondria.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		Y164 R165
Binding residue
(residue number reindexed from 1)		Y100 R101
Enzymatic activity
Enzyme Commision number 3.1.15.-
Gene Ontology
Molecular Function
GO:0000175 3'-5'-RNA exonuclease activity
GO:0003676 nucleic acid binding

View graph for
Molecular Function
External links
PDB RCSB:6rcn, PDBe:6rcn, PDBj:6rcn
PDBsum6rcn
PubMed31588022
UniProtQ9Y3B8|ORN_HUMAN Oligoribonuclease, mitochondrial (Gene Name=REXO2)

[Back to BioLiP]