Structure of PDB 6ra4 Chain B Binding Site BS01

Receptor Information
>6ra4 Chain B (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPTAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEI
THCGQMKRKYRVCNVTRRPASHQTFPLQTVECTVAQYFKDRHKLVLRYPH
LPCLQVGQEQKHTYLPLEVCNIVAGQRCIK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ra4 How to Computationally Stack the Deck for Hit-to-Lead Generation: In Silico Molecular Interaction Energy Profiling for de Novo siRNA Guide Strand Surrogate Selection.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q266 K268
Binding residue
(residue number reindexed from 1)		Q55 K57
Enzymatic activity
Enzyme Commision number 3.1.26.n2: argonaute-2.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6ra4, PDBe:6ra4, PDBj:6ra4
PDBsum6ra4
PubMed31021613
UniProtQ9UKV8|AGO2_HUMAN Protein argonaute-2 (Gene Name=AGO2)

[Back to BioLiP]