Structure of PDB 6r57 Chain B Binding Site BS01

Receptor Information
>6r57 Chain B (length=192) Species: 1496 (Clostridioides difficile) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TTIQQNKDTLSQIVVFPTGNYDKNEANAMVNRLANIDGKYLNALKQNNLK
IKLLSGKLTDEKEYAYLKGVVPKGWEGTGKTWDDVPGLGGSTVALRIGFS
NKGKGHDAINLELHATAHAIDHIVLNDISKSAQFKQIFAKEGRSLGNVNF
LGVYPAEFFAESFAYYYLNQDTNSKLKSACPQTYSFLQNLAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r57 Molecular determinants of the mechanism and substrate specificity ofClostridium difficileproline-proline endopeptidase-1.
Resolution1.899 Å
Binding residue
(original residue number in PDB)
P100 K101 W103 W110 G115 L116 G117 S119 H134 D135 L139 H142 H146 H150 N175 F178 E185
Binding residue
(residue number reindexed from 1)
P72 K73 W75 W82 G87 L88 G89 S91 H106 D107 L111 H114 H118 H122 N147 F150 E157
Enzymatic activity
Enzyme Commision number 3.4.24.89: Pro-Pro endopeptidase.
Gene Ontology
Molecular Function
GO:0008237 metallopeptidase activity
GO:0046872 metal ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6r57, PDBe:6r57, PDBj:6r57
PDBsum6r57
PubMed31182482
UniProtQ183R7|PPEP1_CLOD6 Pro-Pro endopeptidase (Gene Name=zmp1)

[Back to BioLiP]