Structure of PDB 6r2v Chain B Binding Site BS01

Receptor Information
>6r2v Chain B (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPREQDRFLPIANVSRIMKKALPANAKISKDAKETMQECVSEFISFVTGE
ASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6r2v Structural determinants for NF-Y subunit organization and NF-Y/DNA association in plants.
Resolution2.503 Å
Binding residue
(original residue number in PDB)		Q28 K42 K50 I51 S52 K53 K84
Binding residue
(residue number reindexed from 1)		Q5 K19 K27 I28 S29 K30 K61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r2v, PDBe:6r2v, PDBj:6r2v
PDBsum6r2v
PubMed33098724
UniProtQ9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 (Gene Name=NFYB2)

[Back to BioLiP]