Structure of PDB 6qtp Chain B Binding Site BS01

Receptor Information

>6qtp Chain B (length=189) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVE
KARLDRILNNNEIRQMITAFGTGIGGDFDLAKARYHKIVIMTDADVDGAH
IRTLLLTFFYRFMRPLIEAGYVYIAQPPYKGLGEMNADQLWETTMNPEHR
ALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA

Ligand information

>6qtp Chain E (length=20) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gagcgtacagctgtacgctt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qtp Mechanistic and Structural Basis for the Actions of the Antibacterial Gepotidacin against Staphylococcus aureus Gyrase.
Resolution	2.37 Å
Binding residue (original residue number in PDB)	E435 G436 D437 S438 R458 G459 K460 D512
Binding residue (residue number reindexed from 1)	E20 G21 D22 S23 R43 G44 K45 D97

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6qtp, PDBe:6qtp, PDBj:6qtp
PDBsum	6qtp
PubMed	30757898
UniProt	P66937\|GYRB_STAAN DNA gyrase subunit B (Gene Name=gyrB)

[Back to BioLiP]