Structure of PDB 6qtm Chain B Binding Site BS01

Receptor Information
>6qtm Chain B (length=114) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKSSWRQEWLANLKLISVSLVDEFPSELSDSDRQIINEKMQLLKDIFAN
NLKSAISNNFRESDIIILKGEIEDYPMSSEIKIYYNELQNKPDKARFWSF
MKTQRFVSNMGFDI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qtm The Sir4 H-BRCT domain interacts with phospho-proteins to sequester and repress yeast heterochromatin.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
K971 W974 W978 R1066 W1068 K1072 R1075 N1079
Binding residue
(residue number reindexed from 1)
K3 W6 W10 R96 W98 K102 R105 N109
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6qtm, PDBe:6qtm, PDBj:6qtm
PDBsum6qtm
PubMed31515872
UniProtP11978|SIR4_YEAST Regulatory protein SIR4 (Gene Name=SIR4)

[Back to BioLiP]