Structure of PDB 6qms Chain B Binding Site BS01

Receptor Information
>6qms Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCH
QEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qms Constrained Peptides with Fine-Tuned Flexibility Inhibit NF-Y Transcription Factor Assembly.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E92 S95 F96 S99 E100 E103 L125
Binding residue
(residue number reindexed from 1)		E36 S39 F40 S43 E44 E47 L69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0043565 sequence-specific DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus
GO:0016602 CCAAT-binding factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qms, PDBe:6qms, PDBj:6qms
PDBsum6qms
PubMed31539186
UniProtP25208|NFYB_HUMAN Nuclear transcription factor Y subunit beta (Gene Name=NFYB)

[Back to BioLiP]