Structure of PDB 6qbb Chain B Binding Site BS01

Receptor Information

>6qbb Chain B (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSAP
ATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGT
TEENAGYSTLVGHDTFTKV

Ligand information

>6qbb Chain Q (length=8) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WSHPQFEK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6qbb The Role of Changing Loop Conformations in Streptavidin Versions Engineered for High-affinity Binding of the Strep-tag II Peptide.
Resolution	1.52 Å
Binding residue (original residue number in PDB)	T45 R47 Y54 W79 R84 S88 T90 W108 L110
Binding residue (residue number reindexed from 1)	T31 R33 Y40 W65 R70 S74 T76 W94 L96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:6qbb, PDBe:6qbb, PDBj:6qbb
PDBsum	6qbb
PubMed	33639211
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]